SCOPe 2.02: Domain d3sssb_: 3sss B:

Lineage for d3sssb_ (3sss B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [194973] (2 PDB entries)

8. Domain d3sssb_: 3sss B: [194977]
   automated match to d2a1ba1
   complexed with cl

Details for d3sssb_

PDB Entry: 3sss, 2.05 Å

PDB Description: ccmk1 with residues 103-113 deleted

PDB Compounds: (B:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3sssb_:

Sequence; same for both SEQRES and ATOM records:

>d3sssb_ d.58.56.1 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
iavgmietlgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagve
nvkrvnggqvlsthiiarphenleyvlpiryteaveqfrele

Timeline for d3sssb_:

• d3sssb_ is new in SCOPe 2.02-stable
  
• d3sssb_ appears in SCOPe 2.03
  
• d3sssb_ appears in the current release, SCOPe 2.08, called d3sssb1