Lineage for d3vgnb_ (3vgn B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197250Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 1197251Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1197307Species Pseudomonas putida [TaxId:303] [54437] (35 PDB entries)
    Uniprot P07445
  8. 1197318Domain d3vgnb_: 3vgn B: [194777]
    automated match to d1e3vb_
    complexed with fnn

Details for d3vgnb_

PDB Entry: 3vgn (more details), 1.3 Å

PDB Description: crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 3-fluoro-4-nitrophenol
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d3vgnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgnb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsv

SCOPe Domain Coordinates for d3vgnb_:

Click to download the PDB-style file with coordinates for d3vgnb_.
(The format of our PDB-style files is described here.)

Timeline for d3vgnb_: