Lineage for d3vk4a_ (3vk4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866508Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1866700Protein automated matches [190399] (9 species)
    not a true protein
  7. 1866733Species Pseudomonas putida [TaxId:303] [187269] (4 PDB entries)
  8. 1866746Domain d3vk4a_: 3vk4 A: [194665]
    automated match to d1ukja_
    complexed with hcs; mutant

Details for d3vk4a_

PDB Entry: 3vk4 (more details), 2.61 Å

PDB Description: crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-homocysteine
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d3vk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk4a_ c.67.1.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d3vk4a_:

Click to download the PDB-style file with coordinates for d3vk4a_.
(The format of our PDB-style files is described here.)

Timeline for d3vk4a_: