Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) |
Protein automated matches [190376] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187223] (3 PDB entries) |
Domain d4ac2b_: 4ac2 B: [194653] automated match to d1ttaa_ complexed with 43f |
PDB Entry: 4ac2 (more details), 1.81 Å
SCOPe Domain Sequences for d4ac2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ac2b_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
Timeline for d4ac2b_: