![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins) |
![]() | Protein Aristolochene synthase [48587] (1 species) |
![]() | Species Fungus (Penicillium roqueforti) [TaxId:5082] [48588] (2 PDB entries) |
![]() | Domain d1dgpa_: 1dgp A: [19448] complexed with fof, foh |
PDB Entry: 1dgp (more details), 2.8 Å
SCOPe Domain Sequences for d1dgpa_:
Sequence, based on SEQRES records: (download)
>d1dgpa_ a.128.1.4 (A:) Aristolochene synthase {Fungus (Penicillium roqueforti) [TaxId: 5082]} tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl rlsadelqdmkaleancakqlsvvndiysydkeeeasrtghkegaflcsavkvlaeeskl gipatkrvlwsmtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr
>d1dgpa_ a.128.1.4 (A:) Aristolochene synthase {Fungus (Penicillium roqueforti) [TaxId: 5082]} tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl rlsadelqdmkaleancakqlsvvndiysydkeeealcsavkvlaeesklgipatkrvlw smtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr
Timeline for d1dgpa_: