Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein) contains C-terminal alpha/beta subdomain |
Protein Mre11 [64428] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [64429] (5 PDB entries) Uniprot Q8U1N9 |
Domain d4hd0a_: 4hd0 A: [194397] automated match to d1ii7a_ complexed with mn; mutant |
PDB Entry: 4hd0 (more details), 2.3 Å
SCOPe Domain Sequences for d4hd0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hd0a_ d.159.1.4 (A:) Mre11 {Pyrococcus furiosus [TaxId: 2261]} mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs eargedyfeiglgdlpegylyyarghihkryetsysgspvvypgslerwdfgdyevryew dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna yvrlnigwrkpfdlteikellnveylkidtwr
Timeline for d4hd0a_: