SCOPe 2.02: Domain d4hd0a_: 4hd0 A:

Lineage for d4hd0a_ (4hd0 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
   contains C-terminal alpha/beta subdomain

6. Protein Mre11 [64428] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64429] (5 PDB entries)
   Uniprot Q8U1N9

8. Domain d4hd0a_: 4hd0 A: [194397]
   automated match to d1ii7a_
   complexed with mn; mutant

Details for d4hd0a_

PDB Entry: 4hd0, 2.3 Å

PDB Description: Mre11 ATLD17/18 mutation retains Tel1/ATM activity but blocks DNA double-strand break repair

PDB Compounds: (A:) DNA double-strand break repair protein mre11

SCOPe Domain Sequences for d4hd0a_:

Sequence; same for both SEQRES and ATOM records:

>d4hd0a_ d.159.1.4 (A:) Mre11 {Pyrococcus furiosus [TaxId: 2261]}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyarghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwr

Timeline for d4hd0a_:

• d4hd0a_ is new in SCOPe 2.02-stable
  
• d4hd0a_ appears in SCOPe 2.03
  
• d4hd0a_ appears in the current release, SCOPe 2.08