SCOPe 2.06: Domain d4h6ja_: 4h6j A:

Lineage for d4h6ja_ (4h6j A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
   contains PAC motif

6. Protein automated matches [191006] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188753] (14 PDB entries)

8. Domain d4h6ja_: 4h6j A: [194250]
   Other proteins in same PDB: d4h6jb1, d4h6jb2
   automated match to d3f1pa_

Details for d4h6ja_

PDB Entry: 4h6j, 1.52 Å

PDB Description: identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.

PDB Compounds: (A:) hypoxia inducible factor 1-alpha

SCOPe Domain Sequences for d4h6ja_:

Sequence; same for both SEQRES and ATOM records:

>d4h6ja_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dsktflsehsldmkfsycderitelmgyepeellgrsiyeyyhaldsdhltkthhdmftk
gqvttgqyrmlakrggyvwvetqatviyntknsqpqcivcvnyvvs

Timeline for d4h6ja_:

• d4h6ja_ first appeared in SCOPe 2.02
  
• d4h6ja_ appears in SCOPe 2.05
  
• d4h6ja_ appears in SCOPe 2.07
  
• d4h6ja_ appears in the current release, SCOPe 2.08