Class a: All alpha proteins [46456] (290 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein automated matches [190089] (9 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries) |
Domain d3zcha_: 3zch A: [194199] automated match to d2ghex_ complexed with epe, hem, k, so4; mutant |
PDB Entry: 3zch (more details), 2 Å
SCOPe Domain Sequences for d3zcha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zcha_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaamsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfada
Timeline for d3zcha_: