Lineage for d2eswb_ (2esw B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2054094Protein automated matches [190043] (6 species)
    not a true protein
  7. 2054156Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)
  8. 2054162Domain d2eswb_: 2esw B: [193825]
    Other proteins in same PDB: d2eswa2
    automated match to d2ak5b_
    complexed with cl, hg

Details for d2eswb_

PDB Entry: 2esw (more details), 2.01 Å

PDB Description: Atomic structure of the N-terminal SH3 domain of mouse beta PIX,p21-activated kinase (PAK)-interacting exchange factor
PDB Compounds: (B:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2eswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eswb_ b.34.2.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

SCOPe Domain Coordinates for d2eswb_:

Click to download the PDB-style file with coordinates for d2eswb_.
(The format of our PDB-style files is described here.)

Timeline for d2eswb_: