Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries) |
Domain d2eswb_: 2esw B: [193825] Other proteins in same PDB: d2eswa2 automated match to d2ak5b_ complexed with cl, hg |
PDB Entry: 2esw (more details), 2.01 Å
SCOPe Domain Sequences for d2eswb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eswb_ b.34.2.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei
Timeline for d2eswb_: