SCOP 1.57: Domain d1e7ab3: 1e7a B:389-582

Lineage for d1e7ab3 (1e7a B:389-582)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.126: Serum albumin [48551] (1 superfamily)

4. Superfamily a.126.1: Serum albumin [48552] (1 family)

5. Family a.126.1.1: Serum albumin [48553] (1 protein)

6. Protein Serum albumin [48554] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (16 PDB entries)

8. Domain d1e7ab3: 1e7a B:389-582 [19365]

Details for d1e7ab3

PDB Entry: 1e7a, 2.2 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic propofol

SCOP Domain Sequences for d1e7ab3:

Sequence; same for both SEQRES and ATOM records:

>d1e7ab3 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d1e7ab3:

• d1e7ab3 first appeared (with stable ids) in SCOP 1.55
  
• d1e7ab3 appears in SCOP 1.59
  
• d1e7ab3 appears in the current release, SCOPe 2.08