Lineage for d3u0la_ (3u0l A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199516Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (17 PDB entries)
  8. 1199522Domain d3u0la_: 3u0l A: [193475]
    automated match to d3e5va_
    complexed with act

Details for d3u0la_

PDB Entry: 3u0l (more details), 1.25 Å

PDB Description: Crystal structure of the engineered fluorescent protein mRuby, crystal form 1, pH 4.5
PDB Compounds: (A:) mRuby

SCOPe Domain Sequences for d3u0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u0la_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
slikenmrmkvvlegsvnghqfkctgegegnpymgtqtmrikvieggplpfafdilatsf
mygsrtfikypkgipdffkqsfpegftwervtryedggvitvmqdtsledgclvyhaqvr
gvnfpsngavmqkktkgwepntemmypadgglrgythmalkvdggghlscsfvttyrskk
tvgnikmpgihavshrlerleesdnemfvvqrehavakf

SCOPe Domain Coordinates for d3u0la_:

Click to download the PDB-style file with coordinates for d3u0la_.
(The format of our PDB-style files is described here.)

Timeline for d3u0la_: