SCOPe 2.08: Domain d2p6hb_: 2p6h B:

Lineage for d2p6hb_ (2p6h B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.273: YjbQ-like [111037] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets

4. Superfamily d.273.1: YjbQ-like [111038] (2 families)

5. Family d.273.1.0: automated matches [191413] (1 protein)
   not a true family

6. Protein automated matches [190572] (3 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:56636] [193416] (1 PDB entry)

8. Domain d2p6hb_: 2p6h B: [193417]
   automated match to d1ve0a_
   complexed with so4

Details for d2p6hb_

PDB Entry: 2p6h, 1.95 Å

PDB Description: Crystal structure of hypothetical protein APE1520 from Aeropyrum pernix K1

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2p6hb_:

Sequence; same for both SEQRES and ATOM records:

>d2p6hb_ d.273.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 56636]}
metgsftvkterrlqvldvtgkveewlstvggvngllvvyvphttaavavneaeprlmed
ivefireltkpggpwkhnlvdvnahahlgntiigdsrvipvvggrlslgtwqrilfvemd
gprertvnllylge

Timeline for d2p6hb_:

• d2p6hb_ first appeared in SCOPe 2.02
  
• d2p6hb_ appears in SCOPe 2.07