Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.273: YjbQ-like [111037] (1 superfamily) beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets |
Superfamily d.273.1: YjbQ-like [111038] (2 families) |
Family d.273.1.0: automated matches [191413] (1 protein) not a true family |
Protein automated matches [190572] (3 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [193416] (1 PDB entry) |
Domain d2p6hb_: 2p6h B: [193417] automated match to d1ve0a_ complexed with so4 |
PDB Entry: 2p6h (more details), 1.95 Å
SCOPe Domain Sequences for d2p6hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6hb_ d.273.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 56636]} metgsftvkterrlqvldvtgkveewlstvggvngllvvyvphttaavavneaeprlmed ivefireltkpggpwkhnlvdvnahahlgntiigdsrvipvvggrlslgtwqrilfvemd gprertvnllylge
Timeline for d2p6hb_: