SCOPe 2.06: Domain d4hn1a1: 4hn1 A:1-196

Lineage for d4hn1a1 (4hn1 A:1-196)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (23 species)
   not a true protein

7. Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries)

8. Domain d4hn1a1: 4hn1 A:1-196 [193360]
   Other proteins in same PDB: d4hn1a2, d4hn1b2, d4hn1c2, d4hn1d2
   automated match to d2c0za1
   complexed with edo, tdr, thm, tyd; mutant

Details for d4hn1a1

PDB Entry: 4hn1, 1.6 Å

PDB Description: Crystal Structure of H60N/Y130F double mutant of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP

PDB Compounds: (A:) Putative 3-epimerase in D-allose pathway

SCOPe Domain Sequences for d4hn1a1:

Sequence; same for both SEQRES and ATOM records:

>d4hn1a1 b.82.1.0 (A:1-196) automated matches {Streptomyces bikiniensis [TaxId: 1896]}
mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
llptyqawqeqqqaqr

Timeline for d4hn1a1:

• d4hn1a1 first appeared in SCOPe 2.02, called d4hn1a_
  
• d4hn1a1 was called d4hn1a_ in SCOPe 2.05
  
• d4hn1a1 appears in SCOPe 2.07
  
• d4hn1a1 appears in the current release, SCOPe 2.08