Lineage for d4gxxa_ (4gxx A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117059Protein Hemagglutinin [49824] (5 species)
    includes rudiment esterase domain
  7. 1117060Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (2 PDB entries)
  8. 1117061Domain d4gxxa_: 4gxx A: [193317]
    automated match to d3gbna_
    complexed with nag

Details for d4gxxa_

PDB Entry: 4gxx (more details), 1.8 Å

PDB Description: crystal structure of the "avianized" 1918 influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4gxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxxa_ b.19.1.2 (A:) Hemagglutinin {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
gdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniag
wllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpk
tsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgv
hhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdt
itfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvt
igecpkyvrstklrmatglrnip

SCOPe Domain Coordinates for d4gxxa_:

Click to download the PDB-style file with coordinates for d4gxxa_.
(The format of our PDB-style files is described here.)

Timeline for d4gxxa_: