Lineage for d2hcma_ (2hcm A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167639Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1167640Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1167923Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 1167924Protein automated matches [190475] (3 species)
    not a true protein
  7. 1167958Species Mus musculus [TaxId:10090] [193198] (1 PDB entry)
  8. 1167959Domain d2hcma_: 2hcm A: [193199]
    automated match to d2nt2a_
    complexed with gol, na, wo4, zn

Details for d2hcma_

PDB Entry: 2hcm (more details), 2 Å

PDB Description: crystal structure of mouse putative dual specificity phosphatase complexed with zinc tungstate, new york structural genomics consortium
PDB Compounds: (A:) Dual specificity protein phosphatase

SCOPe Domain Sequences for d2hcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcma_ c.45.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
slgtseaapppfarvapalfignaraagatellvragitlcvnvsrqqpgprapgvaelr
vpvfddpaedllthleptcaameaavrdggsclvyckngrsrsaavctaylmrhrghsld
rafqmvksarpvaepnlgfwaqlqkyeqtlqaqailpre

SCOPe Domain Coordinates for d2hcma_:

Click to download the PDB-style file with coordinates for d2hcma_.
(The format of our PDB-style files is described here.)

Timeline for d2hcma_: