SCOPe 2.06: Domain d3zo0b1: 3zo0 B:9-186

Lineage for d3zo0b1 (3zo0 B:9-186)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.22: SPRY domain [141154] (6 proteins)
   Pfam PF00622

6. Protein automated matches [190921] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)

8. Domain d3zo0b1: 3zo0 B:9-186 [193163]
   Other proteins in same PDB: d3zo0a1, d3zo0a2, d3zo0b2
   automated match to d2volb_
   complexed with fuc, man

Details for d3zo0b1

PDB Entry: 3zo0, 1.99 Å

PDB Description: mouse igg2a in complex with mouse trim21 pryspry

PDB Compounds: (B:) e3 ubiquitin-protein ligase trim21

SCOPe Domain Sequences for d3zo0b1:

Sequence; same for both SEQRES and ATOM records:

>d3zo0b1 b.29.1.22 (B:9-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywev
dvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppcqi
gifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

Timeline for d3zo0b1:

• d3zo0b1 first appeared in SCOPe 2.02, called d3zo0b_
  
• d3zo0b1 was called d3zo0b_ in SCOPe 2.05
  
• d3zo0b1 appears in SCOPe 2.07
  
• d3zo0b1 appears in the current release, SCOPe 2.08