Lineage for d4k4we1 (4k4w E:1-461)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623336Protein automated matches [190260] (25 species)
    not a true protein
  7. 2623580Species Human poliovirus 1 [TaxId:12081] [193135] (16 PDB entries)
  8. 2623593Domain d4k4we1: 4k4w E:1-461 [193144]
    Other proteins in same PDB: d4k4wa2, d4k4we2
    automated match to d1ra6a_
    protein/RNA complex

Details for d4k4we1

PDB Entry: 4k4w (more details), 2.69 Å

PDB Description: Poliovirus polymerase elongation complex (r5+2_form)
PDB Compounds: (E:) RNA-directed RNA polymerase 3D-POL

SCOPe Domain Sequences for d4k4we1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4we1 e.8.1.4 (E:1-461) automated matches {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgasgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlyrrwldsf

SCOPe Domain Coordinates for d4k4we1:

Click to download the PDB-style file with coordinates for d4k4we1.
(The format of our PDB-style files is described here.)

Timeline for d4k4we1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k4we2