![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.12: FIS-like [100918] (4 proteins) |
![]() | Protein FIS protein [48285] (2 species) includes N-terminal dimerisation subdomain |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226820] (15 PDB entries) |
![]() | Domain d4ihwb_: 4ihw B: [193093] automated match to d3iv5b_ protein/DNA complex |
PDB Entry: 4ihw (more details), 2.7 Å
SCOPe Domain Sequences for d4ihwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihwb_ a.4.1.12 (B:) FIS protein {Escherichia coli K-12 [TaxId: 83333]} mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq plldmvmqytrgnqtraalmmginrgtlrkklkkygmn
Timeline for d4ihwb_: