Lineage for d4aoua_ (4aou A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873551Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1873552Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1873882Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 1873883Protein automated matches [190603] (14 species)
    not a true protein
  7. 1873916Species Clostridium thermocellum [TaxId:1515] [192994] (2 PDB entries)
  8. 1873921Domain d4aoua_: 4aou A: [193002]
    automated match to d2uxqa_
    complexed with ict, mg, nap

Details for d4aoua_

PDB Entry: 4aou (more details), 2.5 Å

PDB Description: ctidh bound to nadp. the complex structures of isocitrate dehydrogenase from clostridium thermocellum and desulfotalea psychrophila, support a new active site locking mechanism
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d4aoua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aoua_ c.77.1.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
skikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaa
raiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfv
kgwkkpisiarhaygdvyknveyyvpsagkaelvftsengevsrqtihefdgpgvimgmh
ntdksirsfaracfnyaldmnqdlwfstkdtisktydhrfkdifqeiyeneykekfeakn
lqyfytliddavariirseggmvwacknydgdvmsdmvasafgslammtsvlvspdgkye
feaahgtvtrhyykhlkgeetstnsmatifawtgalkkrgeldgikelvdfatkleqasv
qtiengvmtkdlaslsevpekkivntedflkeirktfegma

SCOPe Domain Coordinates for d4aoua_:

Click to download the PDB-style file with coordinates for d4aoua_.
(The format of our PDB-style files is described here.)

Timeline for d4aoua_: