![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (14 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [192994] (2 PDB entries) |
![]() | Domain d4aoyc_: 4aoy C: [192999] automated match to d2uxqa_ |
PDB Entry: 4aoy (more details), 2.35 Å
SCOPe Domain Sequences for d4aoyc_:
Sequence, based on SEQRES records: (download)
>d4aoyc_ c.77.1.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]} skikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaa raiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfv kgwkkpisiarhaygdvyknveyyvpsagkaelvftsengevsrqtihefdgpgvimgmh ntdksirsfaracfnyaldmnqdlwfstkdtisktydhrfkdifqeiyeneykekfeakn lqyfytliddavariirseggmvwacknydgdvmsdmvasafgslammtsvlvspdgkye feaahgtvtrhyykhlkgeetstnsmatifawtgalkkrgeldgikelvdfatkleqasv qtiengvmtkdlaslsevpekkivntedflkeirktfegm
>d4aoyc_ c.77.1.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]} skikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaa raiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfv kgwkkpisiarhnveyyvpsagkaelvftsengevsrqtihefdgpgvimgmhntdksir sfaracfnyaldmnqdlwfstkdtisktydhrfkdifqeiyeneykekfeaknlqyfytl iddavariirseggmvwackndvmsdmvasafgslammtsvlvspdgkyefeaansmati fawtgalkkrgeldgikelvdfatkleqasvqtiengvmtkdlaslsevpekkivntedf lkeirktfegm
Timeline for d4aoyc_: