Lineage for d4jsuy_ (4jsu Y:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1676715Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1676731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (66 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677002Domain d4jsuy_: 4jsu Y: [192973]
    Other proteins in same PDB: d4jsua_, d4jsub_, d4jsuc_, d4jsud_, d4jsug_, d4jsuh_, d4jsui_, d4jsuj_, d4jsul_, d4jsum_, d4jsun_, d4jsuo_, d4jsup_, d4jsuq_, d4jsur_, d4jsuu_, d4jsuv_, d4jsuw_, d4jsux_, d4jsuz_
    automated match to d1jd2r_
    complexed with mes

Details for d4jsuy_

PDB Entry: 4jsu (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:3a
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d4jsuy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jsuy_ d.153.1.4 (Y:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d4jsuy_:

Click to download the PDB-style file with coordinates for d4jsuy_.
(The format of our PDB-style files is described here.)

Timeline for d4jsuy_: