Lineage for d4elhh_ (4elh H:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1384489Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1384490Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1384874Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1384875Protein automated matches [190777] (16 species)
    not a true protein
  7. 1384880Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (19 PDB entries)
  8. 1384890Domain d4elhh_: 4elh H: [192871]
    automated match to d3fl8a_
    complexed with 53i, 53j, ca, cl

Details for d4elhh_

PDB Entry: 4elh (more details), 2.1 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase
PDB Compounds: (H:) dihydrofolate reductase

SCOPe Domain Sequences for d4elhh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elhh_ c.71.1.0 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr

SCOPe Domain Coordinates for d4elhh_:

Click to download the PDB-style file with coordinates for d4elhh_.
(The format of our PDB-style files is described here.)

Timeline for d4elhh_: