Lineage for d1dkfb_ (1dkf B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097647Protein Retinoic acid receptor alpha (RAR-alpha) [48513] (1 species)
  7. 1097648Species Human (Homo sapiens) [TaxId:9606] [48514] (1 PDB entry)
  8. 1097649Domain d1dkfb_: 1dkf B: [19281]
    Other proteins in same PDB: d1dkfa_
    complexed with bms, ola

Details for d1dkfb_

PDB Entry: 1dkf (more details), 2.5 Å

PDB Description: crystal structure of a heterodimeric complex of rar and rxr ligand- binding domains
PDB Compounds: (B:) protein (retinoic acid receptor-alpha)

SCOPe Domain Sequences for d1dkfb_:

Sequence, based on SEQRES records: (download)

>d1dkfb_ a.123.1.1 (B:) Retinoic acid receptor alpha (RAR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pevgeliekvrkahqetfpalcqlgkyttnnsseqrvsldidlwdkfselstkciiktve
fakqlpgfttltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvfafanqllplemddaetgllsaiclicgdrqdleqpdrvdmlqepllealkv
yvrkrrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqemlen

Sequence, based on observed residues (ATOM records): (download)

>d1dkfb_ a.123.1.1 (B:) Retinoic acid receptor alpha (RAR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pevgeliekvrkahqetfpalcqlgkyttseqrvsldidlwdkfselstkciiktvefak
qlpgfttltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnagfgp
ltdlvfafanqllplemddaetgllsaiclicgdrqdleqpdrvdmlqepllealkvyvr
krrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqemlen

SCOPe Domain Coordinates for d1dkfb_:

Click to download the PDB-style file with coordinates for d1dkfb_.
(The format of our PDB-style files is described here.)

Timeline for d1dkfb_: