Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (10 species) not a true protein |
Species Bacillus sphaericus [TaxId:1421] [192699] (1 PDB entry) |
Domain d2quyh_: 2quy H: [192702] Other proteins in same PDB: d2quyd_ automated match to d2oqca_ complexed with cl; mutant |
PDB Entry: 2quy (more details), 1.7 Å
SCOPe Domain Sequences for d2quyh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2quyh_ d.153.1.0 (H:) automated matches {Bacillus sphaericus [TaxId: 1421]} csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst ditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvddvi ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtaspgye whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris avslmaenlnsqdlitfewdrkqdikqln
Timeline for d2quyh_: