Lineage for d2quyh_ (2quy H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937406Species Bacillus sphaericus [TaxId:1421] [192699] (1 PDB entry)
  8. 1937413Domain d2quyh_: 2quy H: [192702]
    Other proteins in same PDB: d2quyd_
    automated match to d2oqca_
    complexed with cl; mutant

Details for d2quyh_

PDB Entry: 2quy (more details), 1.7 Å

PDB Description: truncated mutant asn175ala of penicillin v acylase from bacillus sphaericus
PDB Compounds: (H:) penicillin acylase

SCOPe Domain Sequences for d2quyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quyh_ d.153.1.0 (H:) automated matches {Bacillus sphaericus [TaxId: 1421]}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtaspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqln

SCOPe Domain Coordinates for d2quyh_:

Click to download the PDB-style file with coordinates for d2quyh_.
(The format of our PDB-style files is described here.)

Timeline for d2quyh_: