SCOPe 2.05: Domain d1fqvp1: 1fqv P:85-160

Lineage for d1fqvp1 (1fqv P:85-160)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)

8. Domain d1fqvp1: 1fqv P:85-160 [19269]
   Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd2, d1fqve1, d1fqve2, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp2

Details for d1fqvp1

PDB Entry: 1fqv, 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (P:) skp1

SCOPe Domain Sequences for d1fqvp1:

Sequence; same for both SEQRES and ATOM records:

>d1fqvp1 a.157.1.1 (P:85-160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc

Timeline for d1fqvp1:

• d1fqvp1 first appeared (with stable ids) in SCOP 1.55
  
• d1fqvp1 appears in SCOPe 2.04
  
• d1fqvp1 appears in SCOPe 2.06
  
• d1fqvp1 appears in the current release, SCOPe 2.08