Lineage for d4alqa_ (4alq A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300237Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1300238Protein automated matches [190226] (22 species)
    not a true protein
  7. 1300282Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries)
  8. 1300285Domain d4alqa_: 4alq A: [192642]
    automated match to d4a02a_
    complexed with cu, peg

Details for d4alqa_

PDB Entry: 4alq (more details), 1.48 Å

PDB Description: x-ray photoreduction of polysaccharide monooxygenase cbm33
PDB Compounds: (A:) chitin binding protein

SCOPe Domain Sequences for d4alqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4alqa_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq

SCOPe Domain Coordinates for d4alqa_:

Click to download the PDB-style file with coordinates for d4alqa_.
(The format of our PDB-style files is described here.)

Timeline for d4alqa_: