Lineage for d4i8ga_ (4i8g A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128615Protein Trypsin(ogen) [50515] (9 species)
  7. 1128633Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
    Uniprot P00760
  8. 1128637Domain d4i8ga_: 4i8g A: [192580]
    automated match to d3mfja_
    complexed with ben, ca, gol, so4

Details for d4i8ga_

PDB Entry: 4i8g (more details), 0.8 Å

PDB Description: Bovine trypsin at 0.8 resolution
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4i8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i8ga_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4i8ga_:

Click to download the PDB-style file with coordinates for d4i8ga_.
(The format of our PDB-style files is described here.)

Timeline for d4i8ga_: