Lineage for d3vfaa_ (3vfa A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067871Species Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834] [189723] (3 PDB entries)
  8. 2067874Domain d3vfaa_: 3vfa A: [192561]
    automated match to d2aoga_
    complexed with 031, cl, na; mutant

Details for d3vfaa_

PDB Entry: 3vfa (more details), 1.43 Å

PDB Description: crystal structure of hiv-1 protease mutant v82a with novel p1'-ligands grl-02031
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3vfaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vfaa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 lw12.3 isolate [TaxId: 82834]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf

SCOPe Domain Coordinates for d3vfaa_:

Click to download the PDB-style file with coordinates for d3vfaa_.
(The format of our PDB-style files is described here.)

Timeline for d3vfaa_: