Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) |
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
Protein Urease, beta-subunit [51280] (4 species) |
Species Enterobacter aerogenes [TaxId:548] [192455] (4 PDB entries) |
Domain d4ep8b_: 4ep8 B: [192397] Other proteins in same PDB: d4ep8a_, d4ep8c1, d4ep8c2 automated match to d1ejxb_ complexed with ni |
PDB Entry: 4ep8 (more details), 1.55 Å
SCOPe Domain Sequences for d4ep8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ep8b_ b.85.3.1 (B:) Urease, beta-subunit {Enterobacter aerogenes [TaxId: 548]} mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d4ep8b_: