SCOPe 2.05: Domain d4ep8b_: 4ep8 B:

Lineage for d4ep8b_ (4ep8 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Enterobacter aerogenes [TaxId:548] [192455] (4 PDB entries)

8. Domain d4ep8b_: 4ep8 B: [192397]
   Other proteins in same PDB: d4ep8a_, d4ep8c1, d4ep8c2
   automated match to d1ejxb_
   complexed with ni

Details for d4ep8b_

PDB Entry: 4ep8, 1.55 Å

PDB Description: Initial Urease Structure for Radiation Damage Experiment at 100 K

PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4ep8b_:

Sequence; same for both SEQRES and ATOM records:

>d4ep8b_ b.85.3.1 (B:) Urease, beta-subunit {Enterobacter aerogenes [TaxId: 548]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d4ep8b_:

• d4ep8b_ first appeared in SCOPe 2.02
  
• d4ep8b_ appears in SCOPe 2.04
  
• d4ep8b_ appears in SCOPe 2.06
  
• d4ep8b_ appears in the current release, SCOPe 2.08