![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold |
![]() | Protein automated matches [190186] (3 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [189657] (4 PDB entries) |
![]() | Domain d3zs4a_: 3zs4 A: [192214] automated match to d2y89a_ complexed with 1pr |
PDB Entry: 3zs4 (more details), 1.9 Å
SCOPe Domain Sequences for d3zs4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zs4a_ c.1.2.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mplillpavdvvegravrlvqgkagsqteygsavdaalgwqrdgaewihlvdldaafgrg snhellaevvgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigeh gdqvavgldvqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggp nldllagvadrtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqala avrd
Timeline for d3zs4a_: