SCOPe 2.08: Domain d3umsa1: 3ums A:61-181

Lineage for d3umsa1 (3ums A:61-181)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries)

8. Domain d3umsa1: 3ums A:61-181 [192180]
   Other proteins in same PDB: d3umsa2
   complexed with cl, gdp, so4; mutant

Details for d3umsa1

PDB Entry: 3ums, 2.34 Å

PDB Description: Crystal structure of the G202A mutant of human G-alpha-i1

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i) subunit alpha-1

SCOPe Domain Sequences for d3umsa1:

Sequence; same for both SEQRES and ATOM records:

>d3umsa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d3umsa1:

• d3umsa1 first appeared in SCOPe 2.02
  
• d3umsa1 appears in SCOPe 2.07