Lineage for d1qtea1 (1qte A:1-450)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.5: Bacterial muramidases [48435] (1 family) 
Family a.118.5.1: Bacterial muramidases [48436] (1 protein) Protein 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain [48437] (1 species) Species Escherichia coli [TaxId:562] [48438] (3 PDB entries) 
Domain d1qtea1: 1qte A:1-450 [19183]
Other proteins in same PDB: d1qtea2
Details for d1qtea1
PDB Entry: 1qte (more details), 1.9 Å
PDB Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6- anhydromurotripeptide
SCOP Domain Sequences for d1qtea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtea1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli}
dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
ryafnnqwwdlsvqatiagklwdhleerfp
SCOP Domain Coordinates for d1qtea1:
Click to download the PDB-style file with coordinates for d1qtea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qtea1:
- d1qtea1 appears in SCOP 1.57
- d1qtea1 appears in the current release, SCOPe 2.08
View in 3D
