Lineage for d1qtea1 (1qte A:1-450)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726305Superfamily a.118.5: Bacterial muramidases [48435] (1 family) (S)
  5. 2726306Family a.118.5.1: Bacterial muramidases [48436] (1 protein)
  6. 2726307Protein 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain [48437] (1 species)
  7. 2726308Species Escherichia coli [TaxId:562] [48438] (3 PDB entries)
  8. 2726310Domain d1qtea1: 1qte A:1-450 [19183]
    Other proteins in same PDB: d1qtea2
    complexed with act, ah0, ala, dal, gol, nag, so4

Details for d1qtea1

PDB Entry: 1qte (more details), 1.9 Å

PDB Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6- anhydromurotripeptide
PDB Compounds: (A:) soluble lytic transglycosylase slt70

SCOPe Domain Sequences for d1qtea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtea1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}
dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
ryafnnqwwdlsvqatiagklwdhleerfp

SCOPe Domain Coordinates for d1qtea1:

Click to download the PDB-style file with coordinates for d1qtea1.
(The format of our PDB-style files is described here.)

Timeline for d1qtea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qtea2