Lineage for d3mgrf_ (3mgr F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1082948Domain d3mgrf_: 3mgr F: [191783]
    Other proteins in same PDB: d3mgra_, d3mgrc_, d3mgrd_, d3mgre_, d3mgrg_, d3mgrh_
    automated match to d1kx5b_
    protein/DNA complex; complexed with cl, mn, rb

Details for d3mgrf_

PDB Entry: 3mgr (more details), 2.3 Å

PDB Description: binding of rubidium ions to the nucleosome core particle
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d3mgrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgrf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
akrktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d3mgrf_:

Click to download the PDB-style file with coordinates for d3mgrf_.
(The format of our PDB-style files is described here.)

Timeline for d3mgrf_: