Lineage for d3ljaf_ (3lja F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987576Protein Histone H4 [47125] (7 species)
  7. 1987577Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (57 PDB entries)
  8. 1987658Domain d3ljaf_: 3lja F: [191768]
    Other proteins in same PDB: d3ljaa_, d3ljad_, d3ljae_, d3ljah_
    automated match to d1kx5b_
    protein/DNA complex; complexed with mn, so4

Details for d3ljaf_

PDB Entry: 3lja (more details), 2.75 Å

PDB Description: Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d3ljaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljaf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
akrktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d3ljaf_:

Click to download the PDB-style file with coordinates for d3ljaf_.
(The format of our PDB-style files is described here.)

Timeline for d3ljaf_: