Lineage for d3jvxb_ (3jvx B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180768Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1180769Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1181097Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1181098Protein automated matches [190777] (8 species)
    not a true protein
  7. 1181099Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (19 PDB entries)
  8. 1181121Domain d3jvxb_: 3jvx B: [191746]
    automated match to d3e0ba_
    complexed with ekb, nap

Details for d3jvxb_

PDB Entry: 3jvx (more details), 2.25 Å

PDB Description: crystal structure of bacillus anthracis dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(3,4,5-trimethoxyphenyl) prop-1-ynyl)-6-ethylpyrimidine (ucp120a)
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3jvxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jvxb_ c.71.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
hhhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplp
grrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitk
ihhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d3jvxb_:

Click to download the PDB-style file with coordinates for d3jvxb_.
(The format of our PDB-style files is described here.)

Timeline for d3jvxb_: