SCOPe 2.02: Domain d3h2pb_: 3h2p B:

Lineage for d3h2pb_ (3h2p B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (63 PDB entries)

8. Domain d3h2pb_: 3h2p B: [191736]
   automated match to d3h2pa_
   complexed with ace, mli, zn

Details for d3h2pb_

PDB Entry: 3h2p, 1.55 Å

PDB Description: human sod1 d124v variant

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3h2pb_:

Sequence, based on SEQRES records:

>d3h2pb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekavdlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d3h2pb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekavnagsrl
acgvigiaq

Timeline for d3h2pb_:

• d3h2pb_ is new in SCOPe 2.02-stable
  
• d3h2pb_ appears in SCOPe 2.03
  
• d3h2pb_ appears in the current release, SCOPe 2.08