Lineage for d2p4me_ (2p4m E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899146Protein automated matches [190406] (16 species)
    not a true protein
  7. 1899266Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries)
  8. 1899271Domain d2p4me_: 2p4m E: [191683]
    automated match to d2p4md_
    complexed with iod

Details for d2p4me_

PDB Entry: 2p4m (more details), 1.8 Å

PDB Description: high ph structure of rtms5 h146s variant
PDB Compounds: (E:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d2p4me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4me_ d.22.1.1 (E:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]}
msviatqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspq
cqygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkf
sglnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykak
kpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d2p4me_:

Click to download the PDB-style file with coordinates for d2p4me_.
(The format of our PDB-style files is described here.)

Timeline for d2p4me_: