SCOP 1.61: Domain d1dd4a1: 1dd4 A:1-57

Lineage for d1dd4a1 (1dd4 A:1-57)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)

4. Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family)

5. Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)

6. Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [48303] (2 PDB entries)

8. Domain d1dd4a1: 1dd4 A:1-57 [19035]
   Other proteins in same PDB: d1dd4a2, d1dd4b2

Details for d1dd4a1

PDB Entry: 1dd4, 2.4 Å

PDB Description: Crystal structure of ribosomal protein l12 from thermotoga maritim

SCOP Domain Sequences for d1dd4a1:

Sequence; same for both SEQRES and ATOM records:

>d1dd4a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

Timeline for d1dd4a1:

• d1dd4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1dd4a1 appears in SCOP 1.59
  
• d1dd4a1 appears in SCOP 1.63
  
• d1dd4a1 appears in the current release, SCOPe 2.08