SCOP 1.65: Domain d1f17b1: 1f17 B:204-302

Lineage for d1f17b1 (1f17 B:204-302)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (7 PDB entries)

8. Domain d1f17b1: 1f17 B:204-302 [18798]
   Other proteins in same PDB: d1f17a2, d1f17b2
   complexed with nai; mutant

Details for d1f17b1

PDB Entry: 1f17, 2.3 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with nadh

SCOP Domain Sequences for d1f17b1:

Sequence; same for both SEQRES and ATOM records:

>d1f17b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

Timeline for d1f17b1:

• d1f17b1 first appeared (with stable ids) in SCOP 1.55
  
• d1f17b1 appears in SCOP 1.63
  
• d1f17b1 appears in SCOP 1.67
  
• d1f17b1 appears in the current release, SCOPe 2.08