Lineage for d1f17b1 (1f17 B:204-302)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358781Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 358782Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 358817Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)
  6. 358818Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
    Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI
  7. 358819Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)
  8. 358831Domain d1f17b1: 1f17 B:204-302 [18798]
    Other proteins in same PDB: d1f17a2, d1f17b2
    complexed with nai; mutant

Details for d1f17b1

PDB Entry: 1f17 (more details), 2.3 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with nadh

SCOP Domain Sequences for d1f17b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f17b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOP Domain Coordinates for d1f17b1:

Click to download the PDB-style file with coordinates for d1f17b1.
(The format of our PDB-style files is described here.)

Timeline for d1f17b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f17b2