Lineage for d1pa2a_ (1pa2 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919611Protein Plant peroxidase [48125] (6 species)
  7. 919652Species Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId:3702] [48131] (2 PDB entries)
  8. 919653Domain d1pa2a_: 1pa2 A: [18693]
    complexed with ca, hem, mg

Details for d1pa2a_

PDB Entry: 1pa2 (more details), 1.45 Å

PDB Description: arabidopsis thaliana peroxidase a2
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1pa2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]}
mqlnatfysgtcpnasaivrstiqqalqsdtrigaslirlhfhdcfvngcdasillddtg
siqseknagpnvnsargfnvvdniktalenacpgvvscsdvlalaseasvslaggpswtv
llgrrdsltanlaganssipspieslsnitfkfsavglntndlvalsgahtfgrarcgvf
nnrlfnfsgtgnpdptlnstllstlqqlcpqngsastitnldlstpdafdnnyfanlqsn
dgllqsdqelfsttgsstiaivtsfasnqtlffqafaqsminmgnispltgsngeirldc
kkvngs

SCOPe Domain Coordinates for d1pa2a_:

Click to download the PDB-style file with coordinates for d1pa2a_.
(The format of our PDB-style files is described here.)

Timeline for d1pa2a_: