Lineage for d1qgjb_ (1qgj B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005402Protein Plant peroxidase [48125] (6 species)
  7. 2005454Species Thale cress (Arabidopsis thaliana), peroxidase N [TaxId:3702] [48130] (1 PDB entry)
  8. 2005456Domain d1qgjb_: 1qgj B: [18692]
    complexed with ca, gsh, hem

Details for d1qgjb_

PDB Entry: 1qgj (more details), 1.9 Å

PDB Description: arabidopsis thaliana peroxidase n
PDB Compounds: (B:) peroxidase n

SCOPe Domain Sequences for d1qgjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgjb_ a.93.1.1 (B:) Plant peroxidase {Thale cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]}
qlspdiyakscpnlvqivrkqvaialkaeirmaaslirlhfhdcfvngcdasllldgads
eklaipninsargfevidtikaavenacpgvvscadiltlaardsvvlsggpgwrvalgr
kdglvanqnsannlpspfepldaiiakfvavnlnitdvvalsgahtfgqakcavfsnrlf
nftgagnpdatletsllsnlqtvcplggnsnitapldrsttdtfdnnyfknllegkglls
sdqilfssdlavnttkklveaysrsqslffrdftcamirmgnisngasgevrtncrvinn

SCOPe Domain Coordinates for d1qgjb_:

Click to download the PDB-style file with coordinates for d1qgjb_.
(The format of our PDB-style files is described here.)

Timeline for d1qgjb_: