SCOPe 2.01: Domain d1fhfb_: 1fhf B:

Lineage for d1fhfb_ (1fhf B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Plant peroxidase [48125] (6 species)

7. Species Soybean (Glycine max) [TaxId:3847] [48128] (1 PDB entry)

8. Domain d1fhfb_: 1fhf B: [18688]
   complexed with ca, hem, trs

Details for d1fhfb_

PDB Entry: 1fhf, 2.8 Å

PDB Description: the structure of soybean peroxidase

PDB Compounds: (B:) seed coat peroxidase

SCOPe Domain Sequences for d1fhfb_:

Sequence; same for both SEQRES and ATOM records:

>d1fhfb_ a.93.1.1 (B:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]}
qltptfyretcpnlfpivfgvifdasftdprigaslmrlhfhdcfvqgcdgsvllnntdt
ieseqdalpninsirgldvvndiktavenscpdtvscadilaiaaeiasvlgggpgwpvp
lgrrdsltanrtlanqnlpapffnltqlkasfavqglntldlvtlsgghtfgrarcstfi
nrlynfsntgnpdptlnttylevlrarcpqnatgdnltnldlstpdqfdnryysnllqln
gllqsdqelfstpgadtipivnsfssnqntffsnfrvsmikmgnigvltgdegeirlqcn
fvng

Timeline for d1fhfb_:

• d1fhfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fhfb_ appears in SCOP 1.75
  
• d1fhfb_ appears in SCOPe 2.02
  
• d1fhfb_ appears in the current release, SCOPe 2.08