SCOPe 2.05: Domain d4a91a_: 4a91 A:

Lineage for d4a91a_ (4a91 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Glutamyl-Q tRNA-Asp synthetase YadB [102257] (1 species)
   truncated GluRS and GlnRS homologue lacking the anticodon-binding domain; glutamylates the modified base queuosine (Q) of tRNA-Asp

7. Species Escherichia coli [TaxId:562] [102258] (2 PDB entries)

8. Domain d4a91a_: 4a91 A: [186739]
   automated match to d1nzja_
   protein/RNA complex; complexed with glu, zn

Details for d4a91a_

PDB Entry: 4a91, 1.75 Å

PDB Description: crystal structure of the glutamyl-queuosine trnaasp synthetase from e. coli complexed with l-glutamate

PDB Compounds: (A:) glutamyl-q tRNA(asp) synthetase

SCOPe Domain Sequences for d4a91a_:

Sequence, based on SEQRES records:

>d4a91a_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
dtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilr
qlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvl
hhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhf
qgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpkgd
prpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfs

Sequence, based on observed residues (ATOM records):

>d4a91a_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
dtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilr
qlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvl
hhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhf
qgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqapalpkgdpr
pvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfs

Timeline for d4a91a_:

• d4a91a_ first appeared in SCOPe 2.01
  
• d4a91a_ appears in SCOPe 2.04
  
• d4a91a_ appears in SCOPe 2.06
  
• d4a91a_ appears in the current release, SCOPe 2.08