Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
Protein automated matches [190198] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186941] (37 PDB entries) |
Domain d4a63a_: 4a63 A: [186722] Other proteins in same PDB: d4a63b1, d4a63b2, d4a63d1, d4a63d2, d4a63f1, d4a63f2, d4a63h1, d4a63h2, d4a63j1, d4a63j2 automated match to d1gzha_ complexed with act, zn |
PDB Entry: 4a63 (more details), 2.27 Å
SCOPe Domain Sequences for d4a63a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a63a_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr icacpgrdrkadedhyreaenlyfq
Timeline for d4a63a_: