SCOPe 2.03: Domain d4a63h2: 4a63 H:1056-1120

Lineage for d4a63h2 (4a63 H:1056-1120)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (23 PDB entries)

8. Domain d4a63h2: 4a63 H:1056-1120 [234041]
   Other proteins in same PDB: d4a63a_, d4a63b1, d4a63c_, d4a63d1, d4a63e_, d4a63f1, d4a63g_, d4a63h1, d4a63i_, d4a63j1, d4a63k_
   automated match to d1ycsb2
   complexed with act, zn

Details for d4a63h2

PDB Entry: 4a63, 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution

PDB Compounds: (H:) apoptosis stimulating of p53 protein 2

SCOPe Domain Sequences for d4a63h2:

Sequence; same for both SEQRES and ATOM records:

>d4a63h2 b.34.2.0 (H:1056-1120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lypri

Timeline for d4a63h2:

• d4a63h2 is new in SCOPe 2.03-stable
  
• d4a63h2 appears in SCOPe 2.04
  
• d4a63h2 appears in the current release, SCOPe 2.08