Lineage for d3uk2b1 (3uk2 B:1-279)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469143Species Burkholderia thailandensis [TaxId:271848] [189811] (3 PDB entries)
  8. 2469145Domain d3uk2b1: 3uk2 B:1-279 [186334]
    Other proteins in same PDB: d3uk2a2, d3uk2b2
    automated match to d1ihoa_
    complexed with amp, cl, edo, mlt

Details for d3uk2b1

PDB Entry: 3uk2 (more details), 2.25 Å

PDB Description: The structure of Pantothenate synthetase from Burkholderia thailandensis
PDB Compounds: (B:) Pantothenate synthetase

SCOPe Domain Sequences for d3uk2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uk2b1 c.26.1.0 (B:1-279) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkvissiqelrdqlrgqnrtafvptmgnlheghlslmrlarqhgdpvvasifvnrlqfgp
nedfdkyprtlqedieklqkenvyvlfapterdmypepqeyrvqpphdlgdilegefrpg
fftgvctvvtklmacvqprvavfgkkdyqqlmivrrmcqqlalpveivaaetvrdadgla
lssrnrylseaeraeapelaktlarvrdavldgerdlaaierravahlsargwqpdyvsi
rrrenlvapsaaqieagdplvvltaaklgatrlidnlei

SCOPe Domain Coordinates for d3uk2b1:

Click to download the PDB-style file with coordinates for d3uk2b1.
(The format of our PDB-style files is described here.)

Timeline for d3uk2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uk2b2