Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [189811] (3 PDB entries) |
Domain d3uk2a1: 3uk2 A:1-279 [186333] Other proteins in same PDB: d3uk2a2, d3uk2b2 automated match to d1ihoa_ complexed with amp, cl, edo, mlt |
PDB Entry: 3uk2 (more details), 2.25 Å
SCOPe Domain Sequences for d3uk2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uk2a1 c.26.1.0 (A:1-279) automated matches {Burkholderia thailandensis [TaxId: 271848]} mkvissiqelrdqlrgqnrtafvptmgnlheghlslmrlarqhgdpvvasifvnrlqfgp nedfdkyprtlqedieklqkenvyvlfapterdmypepqeyrvqpphdlgdilegefrpg fftgvctvvtklmacvqprvavfgkkdyqqlmivrrmcqqlalpveivaaetvrdadgla lssrnrylseaeraeapelaktlarvrdavldgerdlaaierravahlsargwqpdyvsi rrrenlvapsaaqieagdplvvltaaklgatrlidnlei
Timeline for d3uk2a1: