Lineage for d3uf0b_ (3uf0 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830773Species Beutenbergia cavernae [TaxId:471853] [189821] (1 PDB entry)
  8. 1830775Domain d3uf0b_: 3uf0 B: [186254]
    automated match to d2c07a1
    complexed with nap

Details for d3uf0b_

PDB Entry: 3uf0 (more details), 2 Å

PDB Description: crystal structure of a putative nad(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy)
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3uf0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uf0b_ c.2.1.0 (B:) automated matches {Beutenbergia cavernae [TaxId: 471853]}
gpfslagrtavvtgagsgigraiahgyaragahvlawgrtdgvkevadeiadgggsaeav
vadladlegaanvaeelaatrrvdvlvnnagiiarapaeevslgrwrevltvnldaawvl
srsfgtamlahgsgrivtiasmlsfqggrnvaayaaskhavvgltralasewagrgvgvn
alapgyvvtantaalradderaaeitaripagrwatpedmvgpavflasdaasyvhgqvl
avdggwlas

SCOPe Domain Coordinates for d3uf0b_:

Click to download the PDB-style file with coordinates for d3uf0b_.
(The format of our PDB-style files is described here.)

Timeline for d3uf0b_: