Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Beutenbergia cavernae [TaxId:471853] [189821] (1 PDB entry) |
Domain d3uf0b_: 3uf0 B: [186254] automated match to d2c07a1 complexed with nap |
PDB Entry: 3uf0 (more details), 2 Å
SCOPe Domain Sequences for d3uf0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uf0b_ c.2.1.0 (B:) automated matches {Beutenbergia cavernae [TaxId: 471853]} gpfslagrtavvtgagsgigraiahgyaragahvlawgrtdgvkevadeiadgggsaeav vadladlegaanvaeelaatrrvdvlvnnagiiarapaeevslgrwrevltvnldaawvl srsfgtamlahgsgrivtiasmlsfqggrnvaayaaskhavvgltralasewagrgvgvn alapgyvvtantaalradderaaeitaripagrwatpedmvgpavflasdaasyvhgqvl avdggwlas
Timeline for d3uf0b_: